PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_9970V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 472aa    MW: 52126.1 Da    PI: 7.6117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_9970V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.5e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv ++++ G g+W++ +++ g+ R++k+c++rw +yl
  Pp3c6_9970V3.2.p 14 KGPWTPDEDQKLVTYIQRNGHGSWRALPKHAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding51.91.8e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rgr++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Pp3c6_9970V3.2.p  67 RGRFSFEEEQVIIHLHGILGNR-WSAIAAHLP-GRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.321961IPR017930Myb domain
SuperFamilySSF466897.49E-3010108IPR009057Homeodomain-like
SMARTSM007172.3E-131363IPR001005SANT/Myb domain
PfamPF002498.8E-161461IPR001005SANT/Myb domain
CDDcd001671.20E-101661No hitNo description
PROSITE profilePS5129425.59962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2665116IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001674.72E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MGRTPCCDKM GLKKGPWTPD EDQKLVTYIQ RNGHGSWRAL PKHAGLLRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEQVIIH LHGILGNRWS AIAAHLPGRT DNEIKNYWNT HLRKRLLQMG  120
IDPVTHKVRS NLLIENLDLK PMVSSTLSHM SQWDRVRMEM EARLSSDYFA KSSAHGAAIF  180
EASGTSASFI KAPSDCSMRS WKTQVSESLL RRDFGVLEKL PPCSMDLQTV LQDWEDSLHC  240
QPMEPGLYDS QMRAKTHSGS HSGYSQTPRN DNCSGTTVTD LAARFETFPS FHQTSPSPSP  300
LPQTSQISDS FTSSGTKLFP DLPKPNSLPS MIPEHFSPTS TLSSPFGTSP SDFMVPPPSS  360
NCEIAFSTSP PLQLPSPTFW TSLSAPTTMG AGDLQLPSEI PELLMELHAE PAVPDLIVAT  420
VPTTTAGTPG WTSQQGLIES KDYWANMLHL VGPPASQQLS TLLSTPARLT R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S317_55V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.18e-85myb domain protein 16